PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_17549.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family bHLH
Protein Properties Length: 209aa    MW: 23084.4 Da    PI: 10.1434
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_17549.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH22.81.6e-072776554
                  HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
           HLH  5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                  ++e E+ RR+r++   e+L +l+Pk  ++++  ++    L  A  YIk+L
  MLOC_17549.1 27 KKESEKERRQRMKALCEKLTSLIPKEHNPHADTMTQQGSLDVAASYIKKL 76
                  6899*********************7567777799999**********99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.892276IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.3E-92791IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000834.16E-42780No hitNo description
Gene3DG3DSA:4.10.280.105.4E-112792IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000106.3E-52776IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003530.00212882IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MEVKAKPARG GKRTRAGVPT ATALMEKKES EKERRQRMKA LCEKLTSLIP KEHNPHADTM  60
TQQGSLDVAA SYIKKLKERV DELQRKKTSV QAMATLRGVS SISTPTTTTT TSSGAGSLEG  120
EKYLDASPTI VEVRQPNDSS MEVRLICSTE KQIKLHEVIT IHEEEGADIV NANHSVAGHK  180
IFYTIHSRAF STRIGMDVSR ITERLKALV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17486KLKERVDELQRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-125HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565225.11e-69PREDICTED: uncharacterized protein LOC100830809
TrEMBLM0V3371e-153M0V337_HORVD; Uncharacterized protein
STRINGMLOC_17549.11e-152(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82936133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G10585.13e-14bHLH family protein